← Back to catalog
Healing & Recovery
PNC-27
PNC-27 10 mg — lyophilized powder, ≥99% purity. 3 ml vial.
$150.0010mg vial · ≥99% (HPLC)
1
Certificate of Analysis available on request after purchase
Description
PNC-27 is a membrane-active peptide combining the p53 HDM-2 binding domain with a transmembrane leader sequence, studied in cancer cell research. Vial size: 3 ml. Vial contents: 10 mg lyophilized powder (>99% purity). Synonyms: p53 HDM-2 binding domain + leader sequence.
Specification
- Molecular formula
- C167H268N50O42
- Molecular weight
- 3661.32 g/mol
- Sequence
- PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG
- Purity (HPLC)
- ≥99% (HPLC)
- CAS number
- Membrane-active anticancer research peptide
- Storage
- Store in a cool, dry place away from light. If reconstituted, refrigerate at 2-8°C. For long-term storage, freeze at -20°C to maintain stability.
For research use only. Not for human consumption, diagnostic, or therapeutic use. Sold exclusively to qualified researchers.